Anti TMEM259 pAb (ATL-HPA054801)

Atlas Antibodies

SKU: ATL-HPA054801-25

• 

Protein Description: transmembrane protein 259
Gene Name: TMEM259
Alternative Gene Name: ASBABP1, C19orf6, MBRL, MGC4022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013858: 47%, ENSRNOG00000012808: 49%
Entrez Gene ID: 91304
Uniprot ID: Q4ZIN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAGGDLGWMAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASM
• Gene Sequence: AAGGDLGWMAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASM
• Gene ID - Mouse: ENSMUSG00000013858
• Gene ID - Rat: ENSRNOG00000012808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.