Anti TMEM255A pAb (ATL-HPA048470)

Atlas Antibodies

SKU:
ATL-HPA048470-100
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic/ membranous positivity in glial cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and TMEM255A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413424).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 255A
Gene Name: TMEM255A
Alternative Gene Name: FAM70A, FLJ20716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036502: 95%, ENSRNOG00000028085: 94%
Entrez Gene ID: 55026
Uniprot ID: Q5JRV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPY
Gene Sequence FKDMNPTLPALNCSVENTHPTVSYYAHPQVASYNTYYHSPPHLPPYSAYDFQHSGVFPSSPPSGLSDEPQSASPSPSYMWSSSAPPRYSPPY
Gene ID - Mouse ENSMUSG00000036502
Gene ID - Rat ENSRNOG00000028085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM255A pAb (ATL-HPA048470)
Datasheet Anti TMEM255A pAb (ATL-HPA048470) Datasheet (External Link)
Vendor Page Anti TMEM255A pAb (ATL-HPA048470) at Atlas Antibodies

Documents & Links for Anti TMEM255A pAb (ATL-HPA048470)
Datasheet Anti TMEM255A pAb (ATL-HPA048470) Datasheet (External Link)
Vendor Page Anti TMEM255A pAb (ATL-HPA048470)