Anti TMEM253 pAb (ATL-HPA052329 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052329-25

• 

Protein Description: transmembrane protein 253
Gene Name: TMEM253
Alternative Gene Name: C14orf176, C14orf95, NCRNA00220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072571: 51%, ENSRNOG00000039489: 51%
Entrez Gene ID: 643382
Uniprot ID: P0C7T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERVGQREQTRAALLPP
• Gene Sequence: LLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERVGQREQTRAALLPP
• Gene ID - Mouse: ENSMUSG00000072571
• Gene ID - Rat: ENSRNOG00000039489
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.