Anti TMEM251 pAb (ATL-HPA048559)

Atlas Antibodies

Catalog No.: ATL-HPA048559-25

Protein Description: transmembrane protein 251
Gene Name: TMEM251
Alternative Gene Name: C14orf109, DKFZP564F1123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046675: 100%, ENSRNOG00000008101: 97%
Entrez Gene ID: 26175
Uniprot ID: Q8N6I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT
• Gene Sequence: TVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT
• Gene ID - Mouse: ENSMUSG00000046675
• Gene ID - Rat: ENSRNOG00000008101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.