Protein Description: transmembrane protein 247
Gene Name: TMEM247
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037689: 53%, ENSRNOG00000046926: 52%
Entrez Gene ID: 388946
Uniprot ID: A6NEH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM247
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037689: 53%, ENSRNOG00000046926: 52%
Entrez Gene ID: 388946
Uniprot ID: A6NEH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SVLVFWMAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRAT |
| Documents & Links for Anti TMEM247 pAb (ATL-HPA079482) | |
| Datasheet | Anti TMEM247 pAb (ATL-HPA079482) Datasheet (External Link) |
| Vendor Page | Anti TMEM247 pAb (ATL-HPA079482) at Atlas |
| Documents & Links for Anti TMEM247 pAb (ATL-HPA079482) | |
| Datasheet | Anti TMEM247 pAb (ATL-HPA079482) Datasheet (External Link) |
| Vendor Page | Anti TMEM247 pAb (ATL-HPA079482) |