Anti TMEM246 pAb (ATL-HPA054041)

Atlas Antibodies

SKU:
ATL-HPA054041-100
  • Immunohistochemical staining of human cerebellum shows strong granular cytoplasmic and nuclear positivity in Purkinje cells.
  • Western blot analysis in human cell line A-549.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 246
Gene Name: TMEM246
Alternative Gene Name: C9orf125, MGC12992
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039611: 97%, ENSRNOG00000006800: 97%
Entrez Gene ID: 84302
Uniprot ID: Q9BRR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAVPEEQIFPVLEHLLRARFSEPHLRDALYLKLYHPE
Gene Sequence PSTNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAVPEEQIFPVLEHLLRARFSEPHLRDALYLKLYHPE
Gene ID - Mouse ENSMUSG00000039611
Gene ID - Rat ENSRNOG00000006800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM246 pAb (ATL-HPA054041)
Datasheet Anti TMEM246 pAb (ATL-HPA054041) Datasheet (External Link)
Vendor Page Anti TMEM246 pAb (ATL-HPA054041) at Atlas Antibodies

Documents & Links for Anti TMEM246 pAb (ATL-HPA054041)
Datasheet Anti TMEM246 pAb (ATL-HPA054041) Datasheet (External Link)
Vendor Page Anti TMEM246 pAb (ATL-HPA054041)