Protein Description: transmembrane protein 240
Gene Name: TMEM240
Alternative Gene Name: C1orf70, SCA21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084845: 97%, ENSRNOG00000042211: 97%
Entrez Gene ID: 339453
Uniprot ID: Q5SV17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM240
Alternative Gene Name: C1orf70, SCA21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084845: 97%, ENSRNOG00000042211: 97%
Entrez Gene ID: 339453
Uniprot ID: Q5SV17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CGRHHIHYVIPYDGDQSVVDASENYFVTDSVTKQEIDLM |
Documents & Links for Anti TMEM240 pAb (ATL-HPA066721) | |
Datasheet | Anti TMEM240 pAb (ATL-HPA066721) Datasheet (External Link) |
Vendor Page | Anti TMEM240 pAb (ATL-HPA066721) at Atlas |
Documents & Links for Anti TMEM240 pAb (ATL-HPA066721) | |
Datasheet | Anti TMEM240 pAb (ATL-HPA066721) Datasheet (External Link) |
Vendor Page | Anti TMEM240 pAb (ATL-HPA066721) |
Citations for Anti TMEM240 pAb (ATL-HPA066721) – 2 Found |
Lin, Ruo-Kai; Su, Chih-Ming; Lin, Shih-Yun; Thi Anh Thu, Le; Liew, Phui-Ly; Chen, Jian-Yu; Tzeng, Huey-En; Liu, Yun-Ru; Chang, Tzu-Hao; Lee, Cheng-Yang; Hung, Chin-Sheng. Hypermethylation of TMEM240 predicts poor hormone therapy response and disease progression in breast cancer. Molecular Medicine (Cambridge, Mass.). 2022;28(1):67. PubMed |
Chang, Shih-Ching; Liew, Phui-Ly; Ansar, Muhamad; Lin, Shih-Yun; Wang, Sheng-Chao; Hung, Chin-Sheng; Chen, Jian-Yu; Jain, Shikha; Lin, Ruo-Kai. Hypermethylation and decreased expression of TMEM240 are potential early-onset biomarkers for colorectal cancer detection, poor prognosis, and early recurrence prediction. Clinical Epigenetics. 2020;12(1):67. PubMed |