Anti TMEM237 pAb (ATL-HPA052596 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052596-25

• 
• 

Protein Description: transmembrane protein 237
Gene Name: TMEM237
Alternative Gene Name: ALS2CR4, JBTS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038079: 88%, ENSRNOG00000024085: 84%
Entrez Gene ID: 65062
Uniprot ID: Q96Q45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP
• Gene Sequence: ELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP
• Gene ID - Mouse: ENSMUSG00000038079
• Gene ID - Rat: ENSRNOG00000024085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.