Protein Description: transmembrane protein 210
Gene Name: TMEM210
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026963: 51%, ENSRNOG00000040275: 52%
Entrez Gene ID: 100505993
Uniprot ID: A6NLX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM210
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026963: 51%, ENSRNOG00000040275: 52%
Entrez Gene ID: 100505993
Uniprot ID: A6NLX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AKGETCPRQVDNRLVENFGVQEDLMDLHPVYVESQLMDADLEVSLVPPLEDQSLVAIPMEASSEEP |
Documents & Links for Anti TMEM210 pAb (ATL-HPA066907 w/enhanced validation) | |
Datasheet | Anti TMEM210 pAb (ATL-HPA066907 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM210 pAb (ATL-HPA066907 w/enhanced validation) at Atlas |
Documents & Links for Anti TMEM210 pAb (ATL-HPA066907 w/enhanced validation) | |
Datasheet | Anti TMEM210 pAb (ATL-HPA066907 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM210 pAb (ATL-HPA066907 w/enhanced validation) |