Anti TMEM200C pAb (ATL-HPA047253)

Atlas Antibodies

SKU:
ATL-HPA047253-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 200C
Gene Name: TMEM200C
Alternative Gene Name: TTMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095407: 61%, ENSRNOG00000049880: 58%
Entrez Gene ID: 645369
Uniprot ID: A6NKL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSQSDDPSSSNKGYTPLREAGTSTESVLDAVAGQTRDSAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQ
Gene Sequence SSQSDDPSSSNKGYTPLREAGTSTESVLDAVAGQTRDSAVAAPVLGAEQSSPEGASQEPPTAEQPQPVQ
Gene ID - Mouse ENSMUSG00000095407
Gene ID - Rat ENSRNOG00000049880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM200C pAb (ATL-HPA047253)
Datasheet Anti TMEM200C pAb (ATL-HPA047253) Datasheet (External Link)
Vendor Page Anti TMEM200C pAb (ATL-HPA047253) at Atlas Antibodies

Documents & Links for Anti TMEM200C pAb (ATL-HPA047253)
Datasheet Anti TMEM200C pAb (ATL-HPA047253) Datasheet (External Link)
Vendor Page Anti TMEM200C pAb (ATL-HPA047253)