Anti TMEM170A pAb (ATL-HPA055071)
Atlas Antibodies
- SKU:
- ATL-HPA055071-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM170A
Alternative Gene Name: FLJ37611, TMEM170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031953: 97%, ENSRNOG00000049019: 58%
Entrez Gene ID: 124491
Uniprot ID: Q8WVE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQQILSLKVVPRVGNGTLCPNSTSLCSFPEM |
Gene Sequence | LQQILSLKVVPRVGNGTLCPNSTSLCSFPEM |
Gene ID - Mouse | ENSMUSG00000031953 |
Gene ID - Rat | ENSRNOG00000049019 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM170A pAb (ATL-HPA055071) | |
Datasheet | Anti TMEM170A pAb (ATL-HPA055071) Datasheet (External Link) |
Vendor Page | Anti TMEM170A pAb (ATL-HPA055071) at Atlas Antibodies |
Documents & Links for Anti TMEM170A pAb (ATL-HPA055071) | |
Datasheet | Anti TMEM170A pAb (ATL-HPA055071) Datasheet (External Link) |
Vendor Page | Anti TMEM170A pAb (ATL-HPA055071) |