Anti TMEM151B pAb (ATL-HPA055167)
Atlas Antibodies
- SKU:
- ATL-HPA055167-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM151B
Alternative Gene Name: bA444E17.5, C6orf137, TMEM193
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096847: 98%, ENSRNOG00000019958: 95%
Entrez Gene ID: 441151
Uniprot ID: Q8IW70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH |
Gene Sequence | CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH |
Gene ID - Mouse | ENSMUSG00000096847 |
Gene ID - Rat | ENSRNOG00000019958 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM151B pAb (ATL-HPA055167) | |
Datasheet | Anti TMEM151B pAb (ATL-HPA055167) Datasheet (External Link) |
Vendor Page | Anti TMEM151B pAb (ATL-HPA055167) at Atlas Antibodies |
Documents & Links for Anti TMEM151B pAb (ATL-HPA055167) | |
Datasheet | Anti TMEM151B pAb (ATL-HPA055167) Datasheet (External Link) |
Vendor Page | Anti TMEM151B pAb (ATL-HPA055167) |