Anti TMEM151B pAb (ATL-HPA055167)

Atlas Antibodies

SKU:
ATL-HPA055167-25
  • Immunohistochemical staining of human cerebral cortex shows strong positivity in nucleoli in neurons.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 151B
Gene Name: TMEM151B
Alternative Gene Name: bA444E17.5, C6orf137, TMEM193
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096847: 98%, ENSRNOG00000019958: 95%
Entrez Gene ID: 441151
Uniprot ID: Q8IW70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH
Gene Sequence CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH
Gene ID - Mouse ENSMUSG00000096847
Gene ID - Rat ENSRNOG00000019958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM151B pAb (ATL-HPA055167)
Datasheet Anti TMEM151B pAb (ATL-HPA055167) Datasheet (External Link)
Vendor Page Anti TMEM151B pAb (ATL-HPA055167) at Atlas Antibodies

Documents & Links for Anti TMEM151B pAb (ATL-HPA055167)
Datasheet Anti TMEM151B pAb (ATL-HPA055167) Datasheet (External Link)
Vendor Page Anti TMEM151B pAb (ATL-HPA055167)