Anti TMEM145 pAb (ATL-HPA060462 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA060462-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-TMEM145 antibody. Corresponding TMEM145 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 145
Gene Name: TMEM145
Alternative Gene Name: FLJ90805
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043843: 100%, ENSRNOG00000020489: 98%
Entrez Gene ID: 284339
Uniprot ID: Q8NBT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTRPSAANKNFPYHVRTSQIASAGVPGPGGSQSADKAFPQHVYGNVTFISDS
Gene Sequence MTRPSAANKNFPYHVRTSQIASAGVPGPGGSQSADKAFPQHVYGNVTFISDS
Gene ID - Mouse ENSMUSG00000043843
Gene ID - Rat ENSRNOG00000020489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti TMEM145 pAb (ATL-HPA060462 w/enhanced validation)
Datasheet Anti TMEM145 pAb (ATL-HPA060462 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM145 pAb (ATL-HPA060462 w/enhanced validation)