Anti TMEM135 pAb (ATL-HPA056685)
Atlas Antibodies
- SKU:
- ATL-HPA056685-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM135
Alternative Gene Name: FLJ22104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039428: 81%, ENSRNOG00000016815: 81%
Entrez Gene ID: 65084
Uniprot ID: Q86UB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC |
Gene Sequence | SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC |
Gene ID - Mouse | ENSMUSG00000039428 |
Gene ID - Rat | ENSRNOG00000016815 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM135 pAb (ATL-HPA056685) | |
Datasheet | Anti TMEM135 pAb (ATL-HPA056685) Datasheet (External Link) |
Vendor Page | Anti TMEM135 pAb (ATL-HPA056685) at Atlas Antibodies |
Documents & Links for Anti TMEM135 pAb (ATL-HPA056685) | |
Datasheet | Anti TMEM135 pAb (ATL-HPA056685) Datasheet (External Link) |
Vendor Page | Anti TMEM135 pAb (ATL-HPA056685) |