Anti TMEM135 pAb (ATL-HPA056685)

Atlas Antibodies

SKU:
ATL-HPA056685-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 135
Gene Name: TMEM135
Alternative Gene Name: FLJ22104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039428: 81%, ENSRNOG00000016815: 81%
Entrez Gene ID: 65084
Uniprot ID: Q86UB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC
Gene Sequence SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC
Gene ID - Mouse ENSMUSG00000039428
Gene ID - Rat ENSRNOG00000016815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM135 pAb (ATL-HPA056685)
Datasheet Anti TMEM135 pAb (ATL-HPA056685) Datasheet (External Link)
Vendor Page Anti TMEM135 pAb (ATL-HPA056685) at Atlas Antibodies

Documents & Links for Anti TMEM135 pAb (ATL-HPA056685)
Datasheet Anti TMEM135 pAb (ATL-HPA056685) Datasheet (External Link)
Vendor Page Anti TMEM135 pAb (ATL-HPA056685)