Anti TMEM133 pAb (ATL-HPA060528)

Atlas Antibodies

SKU:
ATL-HPA060528-25
  • Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 133
Gene Name: TMEM133
Alternative Gene Name: AD031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111475: 35%, ENSRNOG00000028690: 35%
Entrez Gene ID: 83935
Uniprot ID: Q9H2Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTSHHCVGPGNHISWSGHEKEHRLDYCPEVTF
Gene Sequence MTSHHCVGPGNHISWSGHEKEHRLDYCPEVTF
Gene ID - Mouse ENSMUSG00000111475
Gene ID - Rat ENSRNOG00000028690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM133 pAb (ATL-HPA060528)
Datasheet Anti TMEM133 pAb (ATL-HPA060528) Datasheet (External Link)
Vendor Page Anti TMEM133 pAb (ATL-HPA060528) at Atlas Antibodies

Documents & Links for Anti TMEM133 pAb (ATL-HPA060528)
Datasheet Anti TMEM133 pAb (ATL-HPA060528) Datasheet (External Link)
Vendor Page Anti TMEM133 pAb (ATL-HPA060528)