Anti TMEM132A pAb (ATL-HPA051979 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051979-25

• 

Protein Description: transmembrane protein 132A
Gene Name: TMEM132A
Alternative Gene Name: FLJ20539, GBP, HSPA5BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024736: 92%, ENSRNOG00000021338: 90%
Entrez Gene ID: 54972
Uniprot ID: Q24JP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
• Gene Sequence: QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
• Gene ID - Mouse: ENSMUSG00000024736
• Gene ID - Rat: ENSRNOG00000021338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.