Anti TMEM119 pAb (ATL-HPA051870 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051870-25
  • Immunohistochemistry analysis in human lymph node and liver tissues using HPA051870 antibody. Corresponding TMEM119 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 119
Gene Name: TMEM119
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054675: 52%, ENSRNOG00000000700: 46%
Entrez Gene ID: 338773
Uniprot ID: Q4V9L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
Gene Sequence GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
Gene ID - Mouse ENSMUSG00000054675
Gene ID - Rat ENSRNOG00000000700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti TMEM119 pAb (ATL-HPA051870 w/enhanced validation)
Datasheet Anti TMEM119 pAb (ATL-HPA051870 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM119 pAb (ATL-HPA051870 w/enhanced validation)



Citations for Anti TMEM119 pAb (ATL-HPA051870 w/enhanced validation) – 26 Found
Krasemann, Susanne; Madore, Charlotte; Cialic, Ron; Baufeld, Caroline; Calcagno, Narghes; El Fatimy, Rachid; Beckers, Lien; O'Loughlin, Elaine; Xu, Yang; Fanek, Zain; Greco, David J; Smith, Scott T; Tweet, George; Humulock, Zachary; Zrzavy, Tobias; Conde-Sanroman, Patricia; Gacias, Mar; Weng, Zhiping; Chen, Hao; Tjon, Emily; Mazaheri, Fargol; Hartmann, Kristin; Madi, Asaf; Ulrich, Jason D; Glatzel, Markus; Worthmann, Anna; Heeren, Joerg; Budnik, Bogdan; Lemere, Cynthia; Ikezu, Tsuneya; Heppner, Frank L; Litvak, Vladimir; Holtzman, David M; Lassmann, Hans; Weiner, Howard L; Ochando, Jordi; Haass, Christian; Butovsky, Oleg. The TREM2-APOE Pathway Drives the Transcriptional Phenotype of Dysfunctional Microglia in Neurodegenerative Diseases. Immunity. 2017;47(3):566-581.e9.  PubMed
Zrzavy, Tobias; Machado-Santos, Joana; Christine, Sheren; Baumgartner, Christoph; Weiner, Howard L; Butovsky, Oleg; Lassmann, Hans. Dominant role of microglial and macrophage innate immune responses in human ischemic infarcts. Brain Pathology (Zurich, Switzerland). 2018;28(6):791-805.  PubMed
Zheng, Peifen; Wang, Weifeng; Ji, Muxi; Zhu, Qin; Feng, Yuliang; Zhou, Feng; He, Qiaona. TMEM119 silencing inhibits cell viability and causes the apoptosis of gastric cancer SGC-7901 cells. Oncology Letters. 2018;15(6):8281-8286.  PubMed
Zhang, Cun-Jin; Jiang, Meiling; Zhou, Hao; Liu, Weiwei; Wang, Chenhui; Kang, Zizhen; Han, Bing; Zhang, Quanri; Chen, Xing; Xiao, Jianxin; Fisher, Amanda; Kaiser, William J; Murayama, Masanori A; Iwakura, Yoichiro; Gao, Ji; Carman, Julie; Dongre, Ashok; Dubyak, George; Abbott, Derek W; Shi, Fu-Dong; Ransohoff, Richard M; Li, Xiaoxia. TLR-stimulated IRAKM activates caspase-8 inflammasome in microglia and promotes neuroinflammation. The Journal Of Clinical Investigation. 2018;128(12):5399-5412.  PubMed
Bergner, Caroline G; van der Meer, Franziska; Winkler, Anne; Wrzos, Claudia; Türkmen, Mevlude; Valizada, Emil; Fitzner, Dirk; Hametner, Simon; Hartmann, Christian; Pfeifenbring, Sabine; Stoltenburg-Didinger, Gisela; Brück, Wolfgang; Nessler, Stefan; Stadelmann, Christine. Microglia damage precedes major myelin breakdown in X-linked adrenoleukodystrophy and metachromatic leukodystrophy. Glia. 2019;67(6):1196-1209.  PubMed
Ramaglia, Valeria; Sheikh-Mohamed, Salma; Legg, Karen; Park, Calvin; Rojas, Olga L; Zandee, Stephanie; Fu, Fred; Ornatsky, Olga; Swanson, Eric C; Pitt, David; Prat, Alexandre; McKee, Trevor D; Gommerman, Jennifer L. Multiplexed imaging of immune cells in staged multiple sclerosis lesions by mass cytometry. Elife. 2019;8( 31368890)  PubMed
Hayashida, Shotaro; Masaki, Katsuhisa; Suzuki, Satoshi O; Yamasaki, Ryo; Watanabe, Mitsuru; Koyama, Sachiko; Isobe, Noriko; Matsushita, Takuya; Takahashi, Kazuya; Tabira, Takeshi; Iwaki, Toru; Kira, Jun-Ichi. Distinct microglial and macrophage distribution patterns in the concentric and lamellar lesions in Baló's disease and neuromyelitis optica spectrum disorders. Brain Pathology (Zurich, Switzerland). 2020;30(6):1144-1157.  PubMed
Taddei, Raquel N; Sanchez-Mico, Maria V; Bonnar, Orla; Connors, Theresa; Gaona, Angelica; Denbow, Dominique; Frosch, Matthew P; Gómez-Isla, Teresa. Changes in glial cell phenotypes precede overt neurofibrillary tangle formation, correlate with markers of cortical cell damage, and predict cognitive status of individuals at Braak III-IV stages. Acta Neuropathologica Communications. 2022;10(1):72.  PubMed
Uff, Christopher E G; Patel, Karishma; Yeung, Charming; Yip, Ping K. Advances in Visualizing Microglial Cells in Human Central Nervous System Tissue. Biomolecules. 2022;12(5)  PubMed
Zrzavy, Tobias; Hametner, Simon; Wimmer, Isabella; Butovsky, Oleg; Weiner, Howard L; Lassmann, Hans. Loss of 'homeostatic' microglia and patterns of their activation in active multiple sclerosis. Brain : A Journal Of Neurology. 2017;140(7):1900-1913.  PubMed
Zrzavy, T; Höftberger, R; Berger, T; Rauschka, H; Butovsky, O; Weiner, H; Lassmann, H. Pro-inflammatory activation of microglia in the brain of patients with sepsis. Neuropathology And Applied Neurobiology. 2019;45(3):278-290.  PubMed
Hammond, Timothy R; Dufort, Connor; Dissing-Olesen, Lasse; Giera, Stefanie; Young, Adam; Wysoker, Alec; Walker, Alec J; Gergits, Frederick; Segel, Michael; Nemesh, James; Marsh, Samuel E; Saunders, Arpiar; Macosko, Evan; Ginhoux, Florent; Chen, Jinmiao; Franklin, Robin J M; Piao, Xianhua; McCarroll, Steven A; Stevens, Beth. Single-Cell RNA Sequencing of Microglia throughout the Mouse Lifespan and in the Injured Brain Reveals Complex Cell-State Changes. Immunity. 2019;50(1):253-271.e6.  PubMed
Nutma, Erik; Stephenson, Jodie A; Gorter, Rianne P; de Bruin, Joy; Boucherie, Deirdre M; Donat, Cornelius K; Breur, Marjolein; van der Valk, Paul; Matthews, Paul M; Owen, David R; Amor, Sandra. A quantitative neuropathological assessment of translocator protein expression in multiple sclerosis. Brain : A Journal Of Neurology. 2019;142(11):3440-3455.  PubMed
van Wageningen, Thecla A; Vlaar, Eva; Kooij, Gijs; Jongenelen, Cornelis A M; Geurts, Jeroen J G; van Dam, Anne-Marie. Regulation of microglial TMEM119 and P2RY12 immunoreactivity in multiple sclerosis white and grey matter lesions is dependent on their inflammatory environment. Acta Neuropathologica Communications. 2019;7(1):206.  PubMed
Satoh, Jun-Ichi; Kino, Yoshihiro; Yanaizu, Motoaki; Ishida, Tsuyoshi; Saito, Yuko. Microglia express TMEM119 in the brains of Nasu-Hakola disease. Intractable & Rare Diseases Research. 2019;8(4):260-265.  PubMed
Korotkov, Anatoly; Puhakka, Noora; Gupta, Shalini Das; Vuokila, Niina; Broekaart, Diede W M; Anink, Jasper J; Heiskanen, Mette; Karttunen, Jenni; van Scheppingen, Jackelien; Huitinga, Inge; Mills, James D; van Vliet, Erwin A; Pitkänen, Asla; Aronica, Eleonora. Increased expression of miR142 and miR155 in glial and immune cells after traumatic brain injury may contribute to neuroinflammation via astrocyte activation. Brain Pathology (Zurich, Switzerland). 2020;30(5):897-912.  PubMed
Dumas, Anaelle A; Pomella, Nicola; Rosser, Gabriel; Guglielmi, Loredana; Vinel, Claire; Millner, Thomas O; Rees, Jeremy; Aley, Natasha; Sheer, Denise; Wei, Jun; Marisetty, Anantha; Heimberger, Amy B; Bowman, Robert L; Brandner, Sebastian; Joyce, Johanna A; Marino, Silvia. Microglia promote glioblastoma via mTOR-mediated immunosuppression of the tumour microenvironment. The Embo Journal. 2020;39(15):e103790.  PubMed
Snijders, Gijsje J L J; van Zuiden, Welmoed; Sneeboer, Marjolein A M; Berdenis van Berlekom, Amber; van der Geest, Astrid T; Schnieder, Tatiana; MacIntyre, Donald J; Hol, Elly M; Kahn, René S; de Witte, Lot D. A loss of mature microglial markers without immune activation in schizophrenia. Glia. 2021;69(5):1251-1267.  PubMed
van Olst, Lynn; Rodriguez-Mogeda, Carla; Picon, Carmen; Kiljan, Svenja; James, Rachel E; Kamermans, Alwin; van der Pol, Susanne M A; Knoop, Lydian; Michailidou, Iliana; Drost, Evelien; Franssen, Marc; Schenk, Geert J; Geurts, Jeroen J G; Amor, Sandra; Mazarakis, Nicholas D; van Horssen, Jack; de Vries, Helga E; Reynolds, Richard; Witte, Maarten E. Meningeal inflammation in multiple sclerosis induces phenotypic changes in cortical microglia that differentially associate with neurodegeneration. Acta Neuropathologica. 2021;141(6):881-899.  PubMed
Nutma, Erik; Gebro, Emeline; Marzin, Manuel C; van der Valk, Paul; Matthews, Paul M; Owen, David R; Amor, Sandra. Activated microglia do not increase 18 kDa translocator protein (TSPO) expression in the multiple sclerosis brain. Glia. 2021;69(10):2447-2458.  PubMed
Berdowski, Woutje M; van der Linde, Herma C; Breur, Marjolein; Oosterhof, Nynke; Beerepoot, Shanice; Sanderson, Leslie; Wijnands, Lieve I; de Jong, Patrick; Tsai-Meu-Chong, Elisa; de Valk, Walter; de Witte, Moniek; van IJcken, Wilfred F J; Demmers, Jeroen; van der Knaap, Marjo S; Bugiani, Marianna; Wolf, Nicole I; van Ham, Tjakko J. Dominant-acting CSF1R variants cause microglial depletion and altered astrocytic phenotype in zebrafish and adult-onset leukodystrophy. Acta Neuropathologica. 2022;144(2):211-239.  PubMed
Lee, Ji-Hoon; Ryu, Seung W; Ender, Nicolette A; Paull, Tanya T. Poly-ADP-ribosylation drives loss of protein homeostasis in ATM and Mre11 deficiency. Molecular Cell. 2021;81(7):1515-1533.e5.  PubMed
Korotkov, Anatoly; Sim, Nam Suk; Luinenburg, Mark J; Anink, Jasper J; van Scheppingen, Jackelien; Zimmer, Till S; Bongaarts, Anika; Broekaart, Diede W M; Mijnsbergen, Caroline; Jansen, Floor E; Van Hecke, Wim; Spliet, Wim G M; van Rijen, Peter C; Feucht, Martha; Hainfellner, Johannes A; Kršek, Pavel; Zamecnik, Josef; Crino, Peter B; Kotulska, Katarzyna; Lagae, Lieven; Jansen, Anna C; Kwiatkowski, David J; Jozwiak, Sergiusz; Curatolo, Paolo; Mühlebner, Angelika; Lee, Jeong H; Mills, James D; van Vliet, Erwin A; Aronica, Eleonora. MicroRNA-34a activation in tuberous sclerosis complex during early brain development may lead to impaired corticogenesis. Neuropathology And Applied Neurobiology. 2021;47(6):796-811.  PubMed
Borggrewe, Malte; Kooistra, Susanne M; Wesseling, Evelyn M; Gierschek, Fenja L; Brummer, Maaike L; Nowak, Elizabeth C; Medeiros-Furquim, Tiago; Otto, Tegan A; Lee, Sam W; Noelle, Randolph J; Eggen, Bart J L; Laman, Jon D. VISTA regulates microglia homeostasis and myelin phagocytosis, and is associated with MS lesion pathology. Acta Neuropathologica Communications. 2021;9(1):91.  PubMed
De Kleijn, Kim M A; Straasheijm, Kirsten R; Zuure, Wieteke A; Martens, Gerard J M. Molecular Signature of Neuroinflammation Induced in Cytokine-Stimulated Human Cortical Spheroids. Biomedicines. 2022;10(5)  PubMed
Hou, David; Castro, Brandyn; Dapash, Mark; Zolp, Andrew; Katz, Joshua; Arrieta, Víctor; Biermann, Jana; Melms, Johannes; Kueckelhaus, Jan; Benotmane, Jasim; Youngblood, Mark; Rashidi, Aida; Billingham, Leah; Dmello, Crismita; Vazquez-Cervantes, Gustavo; Lopez-Rosas, Aurora; Han, Yu; Patel, Ronit; Chia, Tzu-Yi; Sun, Lu; Prins, Robert; Izar, Benjamin; Heiland, Deiter Henrik; Zhang, Peng; Sonabend, Adam; Miska, Jason; Lesniak, Maciej; Zhao, Junfei; Lee-Chang, Catalina. B-cells Drive Response to PD-1 Blockade in Glioblastoma Upon Neutralization of TGFβ-mediated Immunosuppression. Research Square. 2023; 36711497( 36711497)  PubMed