Anti TMEM110 pAb (ATL-HPA051855)

Atlas Antibodies

SKU:
ATL-HPA051855-25
  • Immunohistochemical staining of human stomach, upper shows distinct cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 110
Gene Name: TMEM110
Alternative Gene Name: MGC52022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006526: 100%, ENSRNOG00000017051: 100%
Entrez Gene ID: 375346
Uniprot ID: Q86TL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEE
Gene Sequence VDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEE
Gene ID - Mouse ENSMUSG00000006526
Gene ID - Rat ENSRNOG00000017051
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM110 pAb (ATL-HPA051855)
Datasheet Anti TMEM110 pAb (ATL-HPA051855) Datasheet (External Link)
Vendor Page Anti TMEM110 pAb (ATL-HPA051855) at Atlas Antibodies

Documents & Links for Anti TMEM110 pAb (ATL-HPA051855)
Datasheet Anti TMEM110 pAb (ATL-HPA051855) Datasheet (External Link)
Vendor Page Anti TMEM110 pAb (ATL-HPA051855)