Anti TMEM110 pAb (ATL-HPA051855)
Atlas Antibodies
- SKU:
- ATL-HPA051855-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TMEM110
Alternative Gene Name: MGC52022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006526: 100%, ENSRNOG00000017051: 100%
Entrez Gene ID: 375346
Uniprot ID: Q86TL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEE |
Gene Sequence | VDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEE |
Gene ID - Mouse | ENSMUSG00000006526 |
Gene ID - Rat | ENSRNOG00000017051 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM110 pAb (ATL-HPA051855) | |
Datasheet | Anti TMEM110 pAb (ATL-HPA051855) Datasheet (External Link) |
Vendor Page | Anti TMEM110 pAb (ATL-HPA051855) at Atlas Antibodies |
Documents & Links for Anti TMEM110 pAb (ATL-HPA051855) | |
Datasheet | Anti TMEM110 pAb (ATL-HPA051855) Datasheet (External Link) |
Vendor Page | Anti TMEM110 pAb (ATL-HPA051855) |