Anti TMEM11 pAb (ATL-HPA051795)

Atlas Antibodies

SKU: ATL-HPA051795-25

• 
• 

Protein Description: transmembrane protein 11
Gene Name: TMEM11
Alternative Gene Name: C17orf35, PM1, PMI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043284: 100%, ENSRNOG00000005377: 100%
Entrez Gene ID: 8834
Uniprot ID: P17152
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIAL
• Gene Sequence: ISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIAL
• Gene ID - Mouse: ENSMUSG00000043284
• Gene ID - Rat: ENSRNOG00000005377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.