Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA047204-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM106C
Alternative Gene Name: MGC5576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052369: 77%, ENSRNOG00000053269: 67%
Entrez Gene ID: 79022
Uniprot ID: Q9BVX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVKISYIGLMTQSSLETHHYVDCGGNSTAI |
Gene Sequence | SVKISYIGLMTQSSLETHHYVDCGGNSTAI |
Gene ID - Mouse | ENSMUSG00000052369 |
Gene ID - Rat | ENSRNOG00000053269 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) | |
Datasheet | Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) | |
Datasheet | Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) |