Anti TMEM106B pAb (ATL-HPA058342)

Atlas Antibodies

SKU: ATL-HPA058342-25

• 
• 

Protein Description: transmembrane protein 106B
Gene Name: TMEM106B
Alternative Gene Name: FLJ11273, MGC33727
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029571: 91%, ENSRNOG00000006206: 87%
Entrez Gene ID: 54664
Uniprot ID: Q9NUM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEF
• Gene Sequence: GKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEF
• Gene ID - Mouse: ENSMUSG00000029571
• Gene ID - Rat: ENSRNOG00000006206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM106B pAb (ATL-HPA058342) – 1 Found

Wang, Ruofan; Simoneau, Camille R; Kulsuptrakul, Jessie; Bouhaddou, Mehdi; Travisano, Katherine A; Hayashi, Jennifer M; Carlson-Stevermer, Jared; Zengel, James R; Richards, Christopher M; Fozouni, Parinaz; Oki, Jennifer; Rodriguez, Lauren; Joehnk, Bastian; Walcott, Keith; Holden, Kevin; Sil, Anita; Carette, Jan E; Krogan, Nevan J; Ott, Melanie; Puschnik, Andreas S. Genetic Screens Identify Host Factors for SARS-CoV-2 and Common Cold Coronaviruses. Cell. 2021;184(1):106-119.e14.