Protein Description: transmembrane protein 100
Gene Name: TMEM100
Alternative Gene Name: FLJ10970, FLJ37856
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069763: 72%, ENSRNOG00000002434: 77%
Entrez Gene ID: 55273
Uniprot ID: Q9NV29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM100
Alternative Gene Name: FLJ10970, FLJ37856
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069763: 72%, ENSRNOG00000002434: 77%
Entrez Gene ID: 55273
Uniprot ID: Q9NV29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG |
Documents & Links for Anti TMEM100 pAb (ATL-HPA055936) | |
Datasheet | Anti TMEM100 pAb (ATL-HPA055936) Datasheet (External Link) |
Vendor Page | Anti TMEM100 pAb (ATL-HPA055936) at Atlas |
Documents & Links for Anti TMEM100 pAb (ATL-HPA055936) | |
Datasheet | Anti TMEM100 pAb (ATL-HPA055936) Datasheet (External Link) |
Vendor Page | Anti TMEM100 pAb (ATL-HPA055936) |