Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047139-25

• 
• 
• 

Protein Description: transmembrane emp24-like trafficking protein 10 (yeast)
Gene Name: TMED10
Alternative Gene Name: P24(DELTA), TMP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021248: 100%, ENSRNOG00000007901: 100%
Entrez Gene ID: 10972
Uniprot ID: P49755
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN
• Gene Sequence: MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN
• Gene ID - Mouse: ENSMUSG00000021248
• Gene ID - Rat: ENSRNOG00000007901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.