Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA047139-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMED10
Alternative Gene Name: P24(DELTA), TMP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021248: 100%, ENSRNOG00000007901: 100%
Entrez Gene ID: 10972
Uniprot ID: P49755
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN |
Gene Sequence | MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN |
Gene ID - Mouse | ENSMUSG00000021248 |
Gene ID - Rat | ENSRNOG00000007901 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation) | |
Datasheet | Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation) | |
Datasheet | Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMED10 pAb (ATL-HPA047139 w/enhanced validation) |