Anti TMCC1 pAb (ATL-HPA053894)

Atlas Antibodies

SKU: ATL-HPA053894-25

• 

Protein Description: transmembrane and coiled-coil domain family 1
Gene Name: TMCC1
Alternative Gene Name: KIAA0779
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030126: 93%, ENSRNOG00000011614: 91%
Entrez Gene ID: 23023
Uniprot ID: O94876
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVLQQIRVPPKMKRGTSLHSRRGKPEAPKGSPQINRKSGQEMTAVMQSGRPRSSST
• Gene Sequence: RVLQQIRVPPKMKRGTSLHSRRGKPEAPKGSPQINRKSGQEMTAVMQSGRPRSSST
• Gene ID - Mouse: ENSMUSG00000030126
• Gene ID - Rat: ENSRNOG00000011614
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.