Anti TMC4 pAb (ATL-HPA048635)

Atlas Antibodies

SKU:
ATL-HPA048635-25
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell line TD47D.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane channel-like 4
Gene Name: TMC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019734: 55%, ENSRNOG00000059741: 56%
Entrez Gene ID: 147798
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEDGGRSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTKTDRWARLLRRSKEKTKEGLRSLQPWAWTLK
Gene Sequence EEDGGRSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTKTDRWARLLRRSKEKTKEGLRSLQPWAWTLK
Gene ID - Mouse ENSMUSG00000019734
Gene ID - Rat ENSRNOG00000059741
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMC4 pAb (ATL-HPA048635)
Datasheet Anti TMC4 pAb (ATL-HPA048635) Datasheet (External Link)
Vendor Page Anti TMC4 pAb (ATL-HPA048635) at Atlas Antibodies

Documents & Links for Anti TMC4 pAb (ATL-HPA048635)
Datasheet Anti TMC4 pAb (ATL-HPA048635) Datasheet (External Link)
Vendor Page Anti TMC4 pAb (ATL-HPA048635)