Protein Description: transmembrane BAX inhibitor motif containing 4
Gene Name: TMBIM4
Alternative Gene Name: CGI-119, GAAP, LFG4, S1R, ZPRO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020225: 32%, ENSRNOG00000004312: 33%
Entrez Gene ID: 51643
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMBIM4
Alternative Gene Name: CGI-119, GAAP, LFG4, S1R, ZPRO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020225: 32%, ENSRNOG00000004312: 33%
Entrez Gene ID: 51643
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL |
| Gene ID - Mouse | ENSMUSG00000020225 |
| Gene ID - Rat | ENSMUSG00000020225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMBIM4 pAb (ATL-HPA077642) | |
| Datasheet | Anti TMBIM4 pAb (ATL-HPA077642) Datasheet (External Link) |
| Vendor Page | Anti TMBIM4 pAb (ATL-HPA077642) at Atlas |
| Documents & Links for Anti TMBIM4 pAb (ATL-HPA077642) | |
| Datasheet | Anti TMBIM4 pAb (ATL-HPA077642) Datasheet (External Link) |
| Vendor Page | Anti TMBIM4 pAb (ATL-HPA077642) |