Anti TMBIM4 pAb (ATL-HPA077642)
Atlas Antibodies
- SKU:
- ATL-HPA077642-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: transmembrane BAX inhibitor motif containing 4
Gene Name: TMBIM4
Alternative Gene Name: CGI-119, GAAP, LFG4, S1R, ZPRO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020225: 32%, ENSRNOG00000004312: 33%
Entrez Gene ID: 51643
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMBIM4
Alternative Gene Name: CGI-119, GAAP, LFG4, S1R, ZPRO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020225: 32%, ENSRNOG00000004312: 33%
Entrez Gene ID: 51643
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL |
Gene Sequence | RYPRSSIEDDFNYGSSVASATVHIRMVLQRDCTFSKQYMRIPSAPSATLNIIRFFHLRQSGRSGMVNIFYKGPTFL |
Gene ID - Mouse | ENSMUSG00000020225 |
Gene ID - Rat | ENSRNOG00000004312 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMBIM4 pAb (ATL-HPA077642) | |
Datasheet | Anti TMBIM4 pAb (ATL-HPA077642) Datasheet (External Link) |
Vendor Page | Anti TMBIM4 pAb (ATL-HPA077642) at Atlas Antibodies |
Documents & Links for Anti TMBIM4 pAb (ATL-HPA077642) | |
Datasheet | Anti TMBIM4 pAb (ATL-HPA077642) Datasheet (External Link) |
Vendor Page | Anti TMBIM4 pAb (ATL-HPA077642) |