Anti TMA7 pAb (ATL-HPA047397)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047397-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMA7
Alternative Gene Name: CCDC72, HSPC016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091537: 95%, ENSRNOG00000047225: 95%
Entrez Gene ID: 51372
Uniprot ID: Q9Y2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE |
Gene Sequence | GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE |
Gene ID - Mouse | ENSMUSG00000091537 |
Gene ID - Rat | ENSRNOG00000047225 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMA7 pAb (ATL-HPA047397) | |
Datasheet | Anti TMA7 pAb (ATL-HPA047397) Datasheet (External Link) |
Vendor Page | Anti TMA7 pAb (ATL-HPA047397) at Atlas Antibodies |
Documents & Links for Anti TMA7 pAb (ATL-HPA047397) | |
Datasheet | Anti TMA7 pAb (ATL-HPA047397) Datasheet (External Link) |
Vendor Page | Anti TMA7 pAb (ATL-HPA047397) |