Anti TM9SF1 pAb (ATL-HPA059249)

Atlas Antibodies

SKU: ATL-HPA059249-25

• 
• 

Protein Description: transmembrane 9 superfamily member 1
Gene Name: TM9SF1
Alternative Gene Name: HMP70, MP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002320: 93%, ENSRNOG00000019710: 93%
Entrez Gene ID: 10548
Uniprot ID: O15321
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP
• Gene Sequence: RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP
• Gene ID - Mouse: ENSMUSG00000002320
• Gene ID - Rat: ENSRNOG00000019710
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.