Anti TM4SF20 pAb (ATL-HPA065531)

Atlas Antibodies

SKU: ATL-HPA065531-25

• 

Protein Description: transmembrane 4 L six family member 20
Gene Name: TM4SF20
Alternative Gene Name: FLJ22800, TCCE518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026149: 52%, ENSRNOG00000015460: 52%
Entrez Gene ID: 79853
Uniprot ID: Q53R12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSV
• Gene Sequence: IHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSV
• Gene ID - Mouse: ENSMUSG00000026149
• Gene ID - Rat: ENSRNOG00000015460
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.