Anti TM2D2 pAb (ATL-HPA047152)

Atlas Antibodies

SKU:
ATL-HPA047152-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TM2 domain containing 2
Gene Name: TM2D2
Alternative Gene Name: BLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031556: 73%, ENSRNOG00000016559: 73%
Entrez Gene ID: 83877
Uniprot ID: Q9BX73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNAT
Gene Sequence TAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNAT
Gene ID - Mouse ENSMUSG00000031556
Gene ID - Rat ENSRNOG00000016559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TM2D2 pAb (ATL-HPA047152)
Datasheet Anti TM2D2 pAb (ATL-HPA047152) Datasheet (External Link)
Vendor Page Anti TM2D2 pAb (ATL-HPA047152) at Atlas Antibodies

Documents & Links for Anti TM2D2 pAb (ATL-HPA047152)
Datasheet Anti TM2D2 pAb (ATL-HPA047152) Datasheet (External Link)
Vendor Page Anti TM2D2 pAb (ATL-HPA047152)