Anti TM2D1 pAb (ATL-HPA046058)

Atlas Antibodies

SKU:
ATL-HPA046058-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TM2 domain containing 1
Gene Name: TM2D1
Alternative Gene Name: BBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028563: 90%, ENSRNOG00000007527: 92%
Entrez Gene ID: 83941
Uniprot ID: Q9BX74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG
Gene Sequence CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG
Gene ID - Mouse ENSMUSG00000028563
Gene ID - Rat ENSRNOG00000007527
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TM2D1 pAb (ATL-HPA046058)
Datasheet Anti TM2D1 pAb (ATL-HPA046058) Datasheet (External Link)
Vendor Page Anti TM2D1 pAb (ATL-HPA046058) at Atlas Antibodies

Documents & Links for Anti TM2D1 pAb (ATL-HPA046058)
Datasheet Anti TM2D1 pAb (ATL-HPA046058) Datasheet (External Link)
Vendor Page Anti TM2D1 pAb (ATL-HPA046058)