Anti TLX3 pAb (ATL-HPA060957)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060957-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TLX3
Alternative Gene Name: HOX11L2, RNX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040610: 100%, ENSRNOG00000004976: 100%
Entrez Gene ID: 30012
Uniprot ID: O43711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA |
Gene Sequence | PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA |
Gene ID - Mouse | ENSMUSG00000040610 |
Gene ID - Rat | ENSRNOG00000004976 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TLX3 pAb (ATL-HPA060957) | |
Datasheet | Anti TLX3 pAb (ATL-HPA060957) Datasheet (External Link) |
Vendor Page | Anti TLX3 pAb (ATL-HPA060957) at Atlas Antibodies |
Documents & Links for Anti TLX3 pAb (ATL-HPA060957) | |
Datasheet | Anti TLX3 pAb (ATL-HPA060957) Datasheet (External Link) |
Vendor Page | Anti TLX3 pAb (ATL-HPA060957) |