Anti TLR4 pAb (ATL-HPA049174)

Atlas Antibodies

SKU: ATL-HPA049174-25

• 

Protein Description: toll-like receptor 4
Gene Name: TLR4
Alternative Gene Name: ARMD10, CD284, hToll, TLR-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039005: 64%, ENSRNOG00000010522: 62%
Entrez Gene ID: 7099
Uniprot ID: O00206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
• Gene Sequence: LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
• Gene ID - Mouse: ENSMUSG00000039005
• Gene ID - Rat: ENSRNOG00000010522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.