Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051828-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-TLN2 antibody. Corresponding TLN2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: talin 2
Gene Name: TLN2
Alternative Gene Name: ILWEQ, KIAA0320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052698: 98%, ENSRNOG00000018373: 98%
Entrez Gene ID: 83660
Uniprot ID: Q9Y4G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMA
Gene Sequence AADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMA
Gene ID - Mouse ENSMUSG00000052698
Gene ID - Rat ENSRNOG00000018373
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation)
Datasheet Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation)
Datasheet Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TLN2 pAb (ATL-HPA051828 w/enhanced validation)