Anti TLE2 pAb (ATL-HPA049103)

Atlas Antibodies

SKU: ATL-HPA049103-25

• 
• 

Protein Description: transducin-like enhancer of split 2
Gene Name: TLE2
Alternative Gene Name: ESG, ESG2, FLJ41188, GRG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034771: 92%, ENSRNOG00000005874: 94%
Entrez Gene ID: 7089
Uniprot ID: Q04725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP
• Gene Sequence: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP
• Gene ID - Mouse: ENSMUSG00000034771
• Gene ID - Rat: ENSRNOG00000005874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.