Anti TIRAP pAb (ATL-HPA054431)

Atlas Antibodies

SKU: ATL-HPA054431-25

• 
• 

Protein Description: toll-interleukin 1 receptor (TIR) domain containing adaptor protein
Gene Name: TIRAP
Alternative Gene Name: Mal, wyatt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032041: 92%, ENSRNOG00000021420: 89%
Entrez Gene ID: 114609
Uniprot ID: P58753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQML
• Gene Sequence: SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQML
• Gene ID - Mouse: ENSMUSG00000032041
• Gene ID - Rat: ENSRNOG00000021420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.