Anti TIPRL pAb (ATL-HPA054282)

Atlas Antibodies

SKU: ATL-HPA054282-25

• 

Protein Description: TOR signaling pathway regulator
Gene Name: TIPRL
Alternative Gene Name: dJ69E11.3, MGC3794, TIP41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040843: 95%, ENSRNOG00000003048: 95%
Entrez Gene ID: 261726
Uniprot ID: O75663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLI
• Gene Sequence: RIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLI
• Gene ID - Mouse: ENSMUSG00000040843
• Gene ID - Rat: ENSRNOG00000003048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.