Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058799-25
  • Immunohistochemistry analysis in human testis and prostate tissues using Anti-TIPIN antibody. Corresponding TIPIN RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and TIPIN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402647).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: TIMELESS interacting protein
Gene Name: TIPIN
Alternative Gene Name: FLJ20516
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032397: 80%, ENSRNOG00000043068: 78%
Entrez Gene ID: 54962
Uniprot ID: Q9BVW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Gene Sequence HEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELS
Gene ID - Mouse ENSMUSG00000032397
Gene ID - Rat ENSRNOG00000043068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)
Datasheet Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)
Datasheet Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TIPIN pAb (ATL-HPA058799 w/enhanced validation)