Protein Description: tubulointerstitial nephritis antigen
Gene Name: TINAG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032357: 67%, ENSRNOG00000058120: 70%
Entrez Gene ID: 27283
Uniprot ID: Q9UJW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TINAG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032357: 67%, ENSRNOG00000058120: 70%
Entrez Gene ID: 27283
Uniprot ID: Q9UJW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYK |
| Documents & Links for Anti TINAG pAb (ATL-HPA073753) | |
| Datasheet | Anti TINAG pAb (ATL-HPA073753) Datasheet (External Link) |
| Vendor Page | Anti TINAG pAb (ATL-HPA073753) at Atlas |
| Documents & Links for Anti TINAG pAb (ATL-HPA073753) | |
| Datasheet | Anti TINAG pAb (ATL-HPA073753) Datasheet (External Link) |
| Vendor Page | Anti TINAG pAb (ATL-HPA073753) |