Anti TIMP1 pAb (ATL-HPA053417)

Atlas Antibodies

SKU: ATL-HPA053417-25

• 

Protein Description: TIMP metallopeptidase inhibitor 1
Gene Name: TIMP1
Alternative Gene Name: CLGI, EPO, TIMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001131: 73%, ENSRNOG00000010208: 68%
Entrez Gene ID: 7076
Uniprot ID: P01033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
• Gene Sequence: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
• Gene ID - Mouse: ENSMUSG00000001131
• Gene ID - Rat: ENSRNOG00000010208
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.