Anti TIMM50 pAb (ATL-HPA056448)

Atlas Antibodies

SKU: ATL-HPA056448-25

• 
• 
• 

Protein Description: translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
Gene Name: TIMM50
Alternative Gene Name: TIM50L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003438: 99%, ENSRNOG00000037638: 99%
Entrez Gene ID: 92609
Uniprot ID: Q3ZCQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
• Gene Sequence: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
• Gene ID - Mouse: ENSMUSG00000003438
• Gene ID - Rat: ENSRNOG00000037638
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.