Anti TIMM50 pAb (ATL-HPA056448)
Atlas Antibodies
- SKU:
- ATL-HPA056448-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TIMM50
Alternative Gene Name: TIM50L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003438: 99%, ENSRNOG00000037638: 99%
Entrez Gene ID: 92609
Uniprot ID: Q3ZCQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC |
Gene Sequence | TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC |
Gene ID - Mouse | ENSMUSG00000003438 |
Gene ID - Rat | ENSRNOG00000037638 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TIMM50 pAb (ATL-HPA056448) | |
Datasheet | Anti TIMM50 pAb (ATL-HPA056448) Datasheet (External Link) |
Vendor Page | Anti TIMM50 pAb (ATL-HPA056448) at Atlas Antibodies |
Documents & Links for Anti TIMM50 pAb (ATL-HPA056448) | |
Datasheet | Anti TIMM50 pAb (ATL-HPA056448) Datasheet (External Link) |
Vendor Page | Anti TIMM50 pAb (ATL-HPA056448) |