Anti TIMM22 pAb (ATL-HPA045138 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045138-25

• 
• 

Protein Description: translocase of inner mitochondrial membrane 22 homolog (yeast)
Gene Name: TIMM22
Alternative Gene Name: TEX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020843: 96%, ENSRNOG00000007988: 95%
Entrez Gene ID: 29928
Uniprot ID: Q9Y584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA
• Gene Sequence: GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA
• Gene ID - Mouse: ENSMUSG00000020843
• Gene ID - Rat: ENSRNOG00000007988
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.