Anti TIMM21 pAb (ATL-HPA051543)

Atlas Antibodies

SKU:
ATL-HPA051543-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear  positivity in neuronal cells and glial cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane 21 homolog (yeast)
Gene Name: TIMM21
Alternative Gene Name: C18orf55, HSPC154, TIM21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024645: 74%, ENSRNOG00000015142: 72%
Entrez Gene ID: 29090
Uniprot ID: Q9BVV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIED
Gene Sequence FSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIED
Gene ID - Mouse ENSMUSG00000024645
Gene ID - Rat ENSRNOG00000015142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TIMM21 pAb (ATL-HPA051543)
Datasheet Anti TIMM21 pAb (ATL-HPA051543) Datasheet (External Link)
Vendor Page Anti TIMM21 pAb (ATL-HPA051543) at Atlas Antibodies

Documents & Links for Anti TIMM21 pAb (ATL-HPA051543)
Datasheet Anti TIMM21 pAb (ATL-HPA051543) Datasheet (External Link)
Vendor Page Anti TIMM21 pAb (ATL-HPA051543)