Anti TIFAB pAb (ATL-HPA049372)
Atlas Antibodies
- SKU:
- ATL-HPA049372-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TIFAB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049625: 69%, ENSRNOG00000011947: 69%
Entrez Gene ID: 497189
Uniprot ID: Q6ZNK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ |
Gene Sequence | PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ |
Gene ID - Mouse | ENSMUSG00000049625 |
Gene ID - Rat | ENSRNOG00000011947 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TIFAB pAb (ATL-HPA049372) | |
Datasheet | Anti TIFAB pAb (ATL-HPA049372) Datasheet (External Link) |
Vendor Page | Anti TIFAB pAb (ATL-HPA049372) at Atlas Antibodies |
Documents & Links for Anti TIFAB pAb (ATL-HPA049372) | |
Datasheet | Anti TIFAB pAb (ATL-HPA049372) Datasheet (External Link) |
Vendor Page | Anti TIFAB pAb (ATL-HPA049372) |