Anti TIFAB pAb (ATL-HPA049372)

Atlas Antibodies

SKU: ATL-HPA049372-25

• 

Protein Description: TRAF-interacting protein with forkhead-associated domain, family member B
Gene Name: TIFAB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049625: 69%, ENSRNOG00000011947: 69%
Entrez Gene ID: 497189
Uniprot ID: Q6ZNK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ
• Gene Sequence: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ
• Gene ID - Mouse: ENSMUSG00000049625
• Gene ID - Rat: ENSRNOG00000011947
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.