Anti TICRR pAb (ATL-HPA049454)

Atlas Antibodies

SKU:
ATL-HPA049454-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: TOPBP1-interacting checkpoint and replication regulator
Gene Name: TICRR
Alternative Gene Name: C15orf42, FLJ41618, MGC45866, SLD3, Treslin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046591: 78%, ENSRNOG00000015520: 82%
Entrez Gene ID: 90381
Uniprot ID: Q7Z2Z1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE
Gene Sequence DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE
Gene ID - Mouse ENSMUSG00000046591
Gene ID - Rat ENSRNOG00000015520
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TICRR pAb (ATL-HPA049454)
Datasheet Anti TICRR pAb (ATL-HPA049454) Datasheet (External Link)
Vendor Page Anti TICRR pAb (ATL-HPA049454) at Atlas Antibodies

Documents & Links for Anti TICRR pAb (ATL-HPA049454)
Datasheet Anti TICRR pAb (ATL-HPA049454) Datasheet (External Link)
Vendor Page Anti TICRR pAb (ATL-HPA049454)