Anti TICRR pAb (ATL-HPA046746)

Atlas Antibodies

SKU: ATL-HPA046746-25

• 

Protein Description: TOPBP1 interacting checkpoint and replication regulator
Gene Name: TICRR
Alternative Gene Name: C15orf42, FLJ41618, MGC45866, SLD3, Treslin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046591: 44%, ENSRNOG00000015520: 43%
Entrez Gene ID: 90381
Uniprot ID: Q7Z2Z1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH
• Gene Sequence: PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH
• Gene ID - Mouse: ENSMUSG00000046591
• Gene ID - Rat: ENSRNOG00000015520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.