Anti THRAP3 pAb (ATL-HPA063765)

Atlas Antibodies

SKU: ATL-HPA063765-25

• 

Protein Description: thyroid hormone receptor associated protein 3
Gene Name: THRAP3
Alternative Gene Name: TRAP150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043962: 93%, ENSRNOG00000009977: 93%
Entrez Gene ID: 9967
Uniprot ID: Q9Y2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL
• Gene Sequence: RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL
• Gene ID - Mouse: ENSMUSG00000043962
• Gene ID - Rat: ENSRNOG00000009977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.