Protein Description: thyroid hormone receptor associated protein 3
Gene Name: THRAP3
Alternative Gene Name: TRAP150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043962: 93%, ENSRNOG00000009977: 93%
Entrez Gene ID: 9967
Uniprot ID: Q9Y2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THRAP3
Alternative Gene Name: TRAP150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043962: 93%, ENSRNOG00000009977: 93%
Entrez Gene ID: 9967
Uniprot ID: Q9Y2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL |
| Documents & Links for Anti THRAP3 pAb (ATL-HPA063765) | |
| Datasheet | Anti THRAP3 pAb (ATL-HPA063765) Datasheet (External Link) |
| Vendor Page | Anti THRAP3 pAb (ATL-HPA063765) at Atlas |
| Documents & Links for Anti THRAP3 pAb (ATL-HPA063765) | |
| Datasheet | Anti THRAP3 pAb (ATL-HPA063765) Datasheet (External Link) |
| Vendor Page | Anti THRAP3 pAb (ATL-HPA063765) |