Anti THOC6 pAb (ATL-HPA052953)

Atlas Antibodies

SKU:
ATL-HPA052953-25
  • Immunohistochemical staining of human skin shows moderate nuclear positivity in keratinocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: THO complex 6 homolog (Drosophila)
Gene Name: THOC6
Alternative Gene Name: fSAP35, MGC2655, WDR58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041319: 95%, ENSRNOG00000003497: 97%
Entrez Gene ID: 79228
Uniprot ID: Q86W42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIR
Gene Sequence TMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIR
Gene ID - Mouse ENSMUSG00000041319
Gene ID - Rat ENSRNOG00000003497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti THOC6 pAb (ATL-HPA052953)
Datasheet Anti THOC6 pAb (ATL-HPA052953) Datasheet (External Link)
Vendor Page Anti THOC6 pAb (ATL-HPA052953) at Atlas Antibodies

Documents & Links for Anti THOC6 pAb (ATL-HPA052953)
Datasheet Anti THOC6 pAb (ATL-HPA052953) Datasheet (External Link)
Vendor Page Anti THOC6 pAb (ATL-HPA052953)