Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045071-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-THOC3 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: THO complex 3
Gene Name: THOC3
Alternative Gene Name: MGC5469, TEX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025872: 100%, ENSRNOG00000000104: 100%
Entrez Gene ID: 84321
Uniprot ID: Q96J01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVT
Gene Sequence PSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVT
Gene ID - Mouse ENSMUSG00000025872
Gene ID - Rat ENSRNOG00000000104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation)
Datasheet Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation)
Datasheet Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti THOC3 pAb (ATL-HPA045071 w/enhanced validation)