Anti THOC2 pAb (ATL-HPA047921)

Atlas Antibodies

SKU: ATL-HPA047921-25

• 
• 
• 

Protein Description: THO complex 2
Gene Name: THOC2
Alternative Gene Name: CXorf3, dJ506G2.1, THO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037475: 98%, ENSRNOG00000007315: 98%
Entrez Gene ID: 57187
Uniprot ID: Q8NI27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKDPPPRNAVASV
• Gene Sequence: VHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKDPPPRNAVASV
• Gene ID - Mouse: ENSMUSG00000037475
• Gene ID - Rat: ENSRNOG00000007315
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.